PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013585108.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 257aa    MW: 29490.9 Da    PI: 5.9601
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013585108.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.43.3e-40311311101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkCa+dC lapyfp++++++f n+hklFG+sn++k++k+l++ e+++am++++++++ara+dP++G++++i++lq ++e +k+el+
  XP_013585108.1  31 ACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKDLSPPEKDAAMHTIMFQSDARANDPIEGCYSIIRRLQYEIEYSKNELD 125
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     +++++l
  XP_013585108.1 126 MVHHQL 131
                     **9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.11430131IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-3631128IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MPSNKPSSIF PLHHKPTPLK PSSSTNTTNQ ACAACKYQRR KCAPDCLLAP YFPHDRHRQF  60
LNAHKLFGVS NITKIIKDLS PPEKDAAMHT IMFQSDARAN DPIEGCYSII RRLQYEIEYS  120
KNELDMVHHQ LAVFRDRAHN HYQEPHMQMQ EPEDLSSSCD LNNNNVVPYS YPLHHVQEPN  180
QQQQQYCSSG NFNGLQEDMW CLQLQESSTT VNMKGGFIDE CEDVKPVEEI SNEFEHHDGF  240
VEDSKLDLPS AQFIVSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2373280.0AC237328.1 Arabidopsis lyrata clone JGIFAFI-41L7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585108.10.0PREDICTED: LOB domain-containing protein 22
RefseqXP_013728511.10.0PREDICTED: LOB domain-containing protein 22-like
SwissprotQ9LRW11e-150LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A078J0750.0A0A078J075_BRANA; BnaCnng28570D protein
TrEMBLA0A0D3CKG30.0A0A0D3CKG3_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.3__1489__AT3G13850.11e-148(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-144LOB domain-containing protein 22